Product Added to your Cart
x

-------- OR --------

EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Diamonds
13 product(s) found for "Diamonds"
0.8mm to 3mm White Round Bri..
Diamonds
0.8mm to 3mm White Round Bri..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Model Number: 0.8mm-3mm Diamond Cut: Excellent Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 0.003-0.1ct Diamond...
Units in Stock: 0
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Model Number: 0.8mm-3mm Diamond Cut: Excellent Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 0.003-0.1ct Diamond...
D VS 1 carat with IGI certif..
Diamonds
D VS 1 carat with IGI certif..
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
1 876,80 €
Units in Stock: 1
1 876,80 €
Details
Add To Cart
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
E VS 1 carat with IGI certif..
Diamonds
E VS 1 carat with IGI certif..
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
1 755,36 €
Units in Stock: 1
1 755,36 €
Details
Add To Cart
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
F DV 1 carat with IGI certif..
Diamonds
F DV 1 carat with IGI certif..
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
1 647,94 €
Units in Stock: 1
1 647,94 €
Details
Add To Cart
Certificate Type: IGI Brand Name: GLP DIAMONDS Place of Origin: Guangxi, China Model Number: Lab grown diamond Gemstone Type: Synthetic (lab created) Gemstone Color: White Gemstone Material: Lab grown...
IGI Certificate 1.0CT Cushio..
Diamonds
IGI Certificate 1.0CT Cushio..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
723,13 €
Units in Stock: 1
723,13 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Emeral..
Diamonds
IGI Certificate 1.0CT Emeral..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
760,49 €
Units in Stock: 1
760,49 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Heart ..
Diamonds
IGI Certificate 1.0CT Heart ..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
788,52 €
Units in Stock: 1
788,52 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Marqui..
Diamonds
IGI Certificate 1.0CT Marqui..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
807,20 €
Units in Stock: 1
807,20 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Oval C..
Diamonds
IGI Certificate 1.0CT Oval C..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
760,49 €
Units in Stock: 1
760,49 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Pear C..
Diamonds
IGI Certificate 1.0CT Pear C..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
858,58 €
Units in Stock: 1
858,58 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Prince..
Diamonds
IGI Certificate 1.0CT Prince..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
690,62 €
Units in Stock: 1
690,62 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
IGI Certificate 1.0CT Radian..
Diamonds
IGI Certificate 1.0CT Radian..
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
732,47 €
Units in Stock: 1
732,47 €
Details
Add To Cart
Place of Origin: Guangxi, China Brand Name: GLP DIAMONDS Diamond Cut: Very Good Diamond Clarity: VS1 Diamond Type: Synthetic (lab created) Diamond Carat Weight: 1.0ct Diamond Enhancements: Filled Diamonds...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i